Cyclized Peptide derived from Myelin P2   Open Access Molecule: peptide derived from myelin P2
Cyclized Peptide derived from CRABP   Open Access Molecule: peptide derived from CRABP
 


Weininger Works Open Access Molecule: MS-BLOCK

MS-BLOCK Overview

MS-BLOCK Basis in Depth

Open Access Molecules (Definition and Disclaimers)

MS-BLOCK Limitations

MS-BLOCK Example Formulations



 Open Access Molecule: MS-BLOCK Overview 

Theilers Murine Encephalomyelitis Virus (TMEV) produces a multiple sclerosis-like condition in animals.

Arthur Weininger and Susan Weininger modeled the TMEV capsid and isolated a myelin P2-like structural feature.
Human myelin P2 presents the same feature on its two helices as is presented by the TMEV capsid.

Further study by Arthur Weininger and Susan Weininger showed that all picornaviruses from a large diverse set contain the same feature.
The structural feature common to TMEV, other picornaviruses, human myelin P2, and CRABP can be superposed. There is good spatial correspondence of the structural feature between structures even without moving residues from their crystal structure positions into complete overlap. Arthur Weininger and Susan Weininger designed peptides that present the residues in the feature that are common to TMEV, myelin P2, and CRABP. These peptides are expected to bind antibodies to any of the myelin P2-like helices or CRABP-like helices found on the diverse set of picornaviruses studied. The compounds are called MS-BLOCK and are Open Access Molecules in all countries.
MYELIN P2-LIKE FEATURE
ON TMEV CAPSID
TMEV-LIKE FEATURE
IN HUMAN MYELIN P2
TMEV FEATURE SUPERPOSED
ON MYELIN P2 FEATURE
TMEV-LIKE, MYELIN P2‑LIKE
  RESIDUES IN MS‑BLOCK
myelin-like feature on TMEV capsid TMEV-like feature in human myelin TMEV feature superposed onmyelin feature TMEV-like, myelin-like residues in MS-BLOCK
TMEV structure ribbons (VP1 and VP3)
are shown in grey.
  TMEV structure ribbons (VP1 and VP3)
are shown in grey.
MS-BLOCK structure ribbon
is shown in grey.
  Myelin P2 structure ribbon
is shown in blue.
Myelin P2 structure ribbon
is shown in blue.
 
Common feature residues are presented as spheres:  LYS   GLU   ASP   ASN   SER  Common feature residues are presented as spheres:  LYS   GLU   ASP   ASN   SER  Common feature residues are presented as spheres:  LYS   GLU   ASP   ASN   SER  Common feature residues are presented as spheres:  LYS   GLU   ASP   ASN   SER 

Back to top


 Open Access Molecule: MS-BLOCK Basis in Depth 

MS-BLOCK was designed to bind to the myelin P2-like helices present in specific picornavirus capsids (the “MS Epitope”). For more information on the MS Epitope, including a structural basis for the exposure of the MS Epitope, see our monograph “Common Features in Picornaviruses, Alpha-bungarotoxin, Myelin P2, and CRABP Suggest Structural Bases for Multiple Sclerosis, Guillain-Barré Syndrome, and Paralysis Induction” (HTML)  (12 MB PDF)   (6 MB PDF)

Back to top


The information below ↓ and including this orange delimiter (and continuous through a matching orange delimiter below) is made freely available by Arthur Weininger and Susan Weininger and may only be redistributed in its entirety and without modification.

 Open Access Molecules (Definition and Disclaimers) 

“Open Access Molecules” are specific molecules upon which Arthur Weininger and Susan Weininger make no proprietary claim with the exception that there may be specific limitations on “Territory” or “Field of Use”. Any such limitations will be listed in the section labeled "Limitations" on the html page describing an individual Open Access Molecule.

Open Access Molecules listed by Arthur Weininger and Susan Weininger are provided “as is” and without warranty of any kind. No oral or written information or advice given by Arthur Weininger and/or Susan Weininger shall create any warranty with regards to Open Access Molecules. Open Access Molecules may not be: useful, safe, or non-infringing of third party rights. Arthur Weininger and Susan Weininger do not agree to any indemnification for anything related to Open Access Molecules including, but not limited to, any use of Open Access Molecules, any legal actions directly or indirectly associated with Open Access Molecules, or any losses or damages directly or indirectly associated with Open Access Molecules. In no event shall the total liability by Arthur Weininger and Susan Weininger for any and all damages related to Open Access Molecules exceed zero.

    Any use of Open Access Molecules is at your sole and entire risk.    

Back to top


 Open Access Molecule: MS-BLOCK Limitations 

Israel Patent Application #235702 for MS-BLOCK was assigned by Arthur Weininger and Susan Weininger to Weininger Works Incorporated. Israel Patent Application #235702 has been abandoned by Weininger Works Incorporated. There are no actual or potential foreign patent applications corresponding to Israeli Patent Application #235702 currently pending in any territory.

Back to top


 Open Access Molecule: MS-BLOCK Example Formulations 

We hope that you will make and test MS-BLOCK compounds for research and preclinical purposes. Clinical applications may potentially include detection and treatment of multiple sclerosis (MS) and amyotrophic lateral sclerosis (ALS). The following images show the structures and sequences of two MS-BLOCK cyclized peptides derived, separately, from myelin P2 protein and CRABP.

cyclized peptides derived from human myelin P2 cyclized peptides derived from CRABP
CYCLIZED PEPTIDE DERIVED FROM MYELIN P2 CYCLIZED PEPTIDE DERIVED FROM CRABP
Residues presented as spheres are colored as follows:
 ARG   LYS   GLU   ASP   ASN   CYS   GLY   PRO 
Residues presented as spheres are colored as follows:
 ARG   LYS   GLU   ASN   CYS   GLY   PRO 
Color coding and sequences of residues shown above:
 1 
 M 
 2 
 C 
 3 
 L 
 4 
 V 
 5 
 S 
 6 
 S 
 7 
 E 
 8 
 N 
 9 
 F 
 10 
 D 
 11 
 D 
 12 
 Y 
 13 
 M 
 14 
 K 
 15 
 A 
 16 
 L 
 17 
 G 
 18 
 V 
 19 
 G 
 20 
 L 
 21 
 A 
 22 
 T 
 23 
 R 
 24 
 K 
 25 
 L 
 26 
 G 
 27 
 N 
 28 
 L 
   
 29 
 A 
 30 
 K 
 31 
 P 
 32 
 C 
 33 
 G 
 34 
 V 
Color coding and sequences of residues shown above:
 1 
 M 
 2 
 C 
 3 
 I 
 4 
 I 
 5 
 R 
 6 
 S 
 7 
 E 
 8 
 N 
 9 
 F 
 10 
 E 
 11 
 E 
 12 
 L 
 13 
 L 
 14 
 K 
 15 
 V 
 16 
 L 
 17 
 G 
 18 
 V 
 19 
 N 
 20 
 V 
 21 
 M 
 22 
 L 
 23 
 R 
 24 
 K 
 25 
 I 
 26 
 A 
 27 
 V 
 28 
 A 
 29 
 A 
 30 
 A 
 31 
 S 
 32 
 K 
 33 
 P 
 34 
 C 
 35 
 G 
 36 
 V 

The following cyclic peptides are example formulations of MS-BLOCK. These cyclic peptides are expected to bind antibodies to any of the myelin P2-like helices or CRABP-like helices found on a diverse set of picornaviruses. The antibodies that bind to MS-BLOCK are expected to cross-react with myelin P2 helices and CRABP helices.

Cyclic peptide derived from myelin P2 protein (34 residues):

    MCLVSSENFDDYMKALGVGLATRKLGNLAKPCGV

Cyclic peptide derived from CRABP (36 residues):

    MCIIRSENFEELLKVLGVNVMLRKIAVAAASKPCGV


The information above ↑ and including this orange delimiter (and continuous through a matching orange delimiter above) is made freely available by Arthur Weininger and Susan Weininger and may only be redistributed in its entirety and without modification.

Back to top


Arthur Weininger and Susan Weininger do not accept confidential information under any circumstance. Weininger Works is a trademark of Arthur Weininger and Susan Weininger. All images constitute content of this website and are copyrighted material of this website.